www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > GRF (rat)

GRF (rat)

Quick view: Suppliers
BGC Id:
293091217632
CAS No.:
Synonyms:
hadaiftssyrrilgqlyarkllheimnrqqgernqeqrsrfn | rat hypothalamic growthhormone-releasing factor | rat growth hormone-releasing factor(1-43) | ghrf | grf (rat)|ghrf, rat | growth hormone releasing factor rat | 122: pn: wo0069900 seqid:126 unclaimed protein | somatoliberin, rat | rat growth hormone-releasing factor | somatoliberin(human pancreatic islet), 1-l-histidine-8-l-serine-12-l-arginine-13-l-isoleucine-18-l-tyrosine-24-l-histidine-25-l-glutamicacid-28-l-asparagine-34-l-arginine-38-l-glutamine-39-l-arginine-40-l-serine-42-l-phenylalanine-43-l-asparagine-44-de-l-leucinamide- | ghrf rat | rat hypothalamic gh-releasing factor | somatoliberin (rathypothalamus) (9ci) | rat growth hormone-releasing factor-43 | l-asparagine, l-histidyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-seryl-l-seryl-l-tyrosyl-l-arginyl-l-arginyl-l-isoleucyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-tyrosyl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-histidyl-l-a-glutamyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminyl-l-arginyl-l-seryl-l-arginyl-l-phenylalanyl- | rat somatoliberin | rat hypothalamic gh-releasing factor(1-43) | grf (1-43) (rat) | rat hypothalamic growth hormone-releasing factor(1-43) | 100: pn: us20090175821 seqid: 126 claimed protein | growth hormone releasing factor (1-43) (rat) | somatotropin releasing hormone (1-43)
Formula:
C225H361 N77 O66 S
Molecular Weight:
5232.82

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG also offers Neuropeptide VF (124-131) (human). Bachem AG is supplier for GRF (rat). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.
Diethylene glycol dibenzoate
Structure

2,4,6-Trichlorophenol sodium salt
Structure

Suppliers and manufactures - with identical CAS number as GRF (rat)

For the following products supplier are listed below:
    GRF (1-43) (rat)


The following companies are not suppliers of GRF (rat) . This companies are suppliers for equal products with the same CAS number. CAS: 86472-71-1


Supplier of

GRF (1-43) (rat)

(CAS: 86472-71-1)

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. 1,3-Dimethyl-6-oxiranyl-2,4-pyrimidinedione will be also provided by us. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Hunan Azeal Materials
Hunan Azeal Materials Co., Ltd. is located in Changsha City, Hunan Province. It is a high-tech mate


Shandong Shimizu Chemic
Japan-China Joint Venture enterprise, mainly produce Dimethyl Isophthalate and polymerizable esters


Rech Chemical Co., Ltd.
Twenties years ago, Rech Chemical Co.,Ltd were mainly a solid manganese sulphate supplier. Today, b


Xperio Impex
Xperio Impex is a global supplier of specialty & industrial chemicals based in New Delhi, India


Jinan Langhua Chemical
As a specialized chemical trader integrating R&D, production, sales and custom synthesis, Jinan


Mayue Longteng Technolo
Founded in 2016, Mayue Longteng Technology Co., Ltd. is located in Wuhan City of Hubei Province; re


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved GRF (rat)